Szegedi Tudományegyetem Ahol tudás és szándék találkozik

2015  --  Beszerzési és Szolgáltatási Iroda (anyagok, eszközök)
Call for Proposal No. SZTE/2015/PB05973
The University of Szeged (hereafter Inviting Authority) invites candidates to an open procedure for supplying the following product:

Synthetic peptides
2015. december 14.
Offer No: SZTE/2015/PB05973

Deadline for submission of offers: December 14th, 2015 11:38

Estimated Date of delivery: 5 weeks ARO

Short specification of product:
  1. Synthetic peptide, Beta Amyloid 1-16

Sequence: DAEFRHDSGYEVHHQK

Modifications: none

Purity: >95%

Quantity: 20 mg

 

2. Synthetic peptide, Beta Amyloid 1-40

Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Modifications: none

Purity: >95%

Quantity: 10 mg



Evaluation principle: the lowest price


Offers are to be submitted by uploading your offer in PDF file (please click on „Upload Proposal”” in the top right corner).
More information:

Jelen beszerzés kizárólagossági nyilatkozat alapján került lefolytatásra.




For further information please turn to the following official contact person:

Lajkóné Takács Ibolya foreign sales representative

E-mail: lajkone.takacs.ibolya@gmf.u-szeged.hu

Contact person for technical support: Mózsik Éva, ügyintéző SZTE TTIK Kémiai Tanszékcsoport Szervetlen és Analitikai Kémiai Tanszék, tel: +36 (62) 544-340, +36 (62) 544-000/4340

email: szakt@chem.u-szeged.hu

The official language of the procedure is Hungarian, but offers can also be submitted in English language. The Inviting Authority expects offers from suppliers that can guarantee a prompt delivery and have a stable financial background. The Inviting Authority reserves the right to request further information from candidates within 5 working days in writing . Request for further information will be sent to each candidate with a valid offer. Following the submission deadline, the Inviting Authority evaluates the offers and candidates are informed on the result with the least possible delay.

The Inviting Authority reserves the right to cancel the above offer procedure fully or partially, without any justification. The Inviting Authority is not liable for consequences resulted by the withdrawal.

This call for proposal is not to be considered as a contractual commitment undertaken by the Inviting Authority. The call and the full procedure are subject to the Inviting Authority’s internal regulations.

Winner supplier: Caslo ApS
Winner price: 1 125 EUR + VAT

Készítő