2015. december 14.
Offer No:
SZTE/2015/PB05973
Deadline for submission of offers: December 14th, 2015 11:38
Estimated Date of delivery: 5 weeks ARO
Short specification of product:
- Synthetic peptide, Beta Amyloid 1-16
Sequence: DAEFRHDSGYEVHHQK
Modifications: none
Purity: >95%
Quantity: 20 mg
2. Synthetic peptide, Beta Amyloid 1-40
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Modifications: none
Purity: >95%
Quantity: 10 mg
Evaluation principle: the lowest price
Offers are to be submitted by uploading your offer in PDF file (please click on „Upload Proposal”” in the top right corner).
More information:
Jelen beszerzés kizárólagossági nyilatkozat alapján került lefolytatásra.
For further information please turn to the following official contact person:
Lajkóné Takács Ibolya foreign sales representative
E-mail:
lajkone.takacs.ibolya@gmf.u-szeged.hu
Contact person for technical support: Mózsik Éva, ügyintéző SZTE TTIK Kémiai Tanszékcsoport Szervetlen és Analitikai Kémiai Tanszék, tel: +36 (62) 544-340, +36 (62) 544-000/4340
email:
szakt@chem.u-szeged.hu
The official language of the procedure is Hungarian, but offers can also be submitted in English language. The Inviting Authority expects offers from suppliers that can guarantee a prompt delivery and have a stable financial background. The Inviting Authority reserves the right to request further information from candidates within 5 working days in writing . Request for further information will be sent to each candidate with a valid offer. Following the submission deadline, the Inviting Authority evaluates the offers and candidates are informed on the result with the least possible delay.
The Inviting Authority reserves the right to cancel the above offer procedure fully or partially, without any justification. The Inviting Authority is not liable for consequences resulted by the withdrawal.
This call for proposal is not to be considered as a contractual commitment undertaken by the Inviting Authority. The call and the full procedure are subject to the Inviting Authority’s internal regulations.
Winner supplier: Caslo ApS
Winner price: 1 125 EUR + VAT